PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100069900051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 340aa    MW: 38211.7 Da    PI: 6.58
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100069900051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like61.81.3e-194178138
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkv 38
                                  kprl+Wt +LHerF+eav+qLGG+ekAtPk++l+lm++
  Ote100069900051|100069900051 41 KPRLKWTLDLHERFIEAVNQLGGAEKATPKSVLKLMGI 78
                                  79**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-163978IPR009057Homeodomain-like
SuperFamilySSF466893.94E-64078IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-124178IPR006447Myb domain, plants
PfamPF143791.7E-22120165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MYHRGHHREK NVHPIPQERH MFLQGVNGTG DSGLVLSSDA KPRLKWTLDL HERFIEAVNQ  60
LGGAEKATPK SVLKLMGIXX XXNLVSLEES PSAKAERVPE VNGPHMCNQN IASQATTNLQ  120
LDEAIQMQIE VQQRLHEQLE VQRHLQMRIE AQGKYLQGVL EKAQESLGRQ NVGTLGLETA  180
KVQLSELVSQ VSSQCLNSAF SGMKQLSDLC QSNQPKDCSV DSCLTSCDQE LYDKHLSLKP  240
MSFRVAADQE IDDKQSLSMS IGLQSGKWDC NXXXXXXXXX XNAKFLEWNN GFNAMKQDKH  300
KSCSEVKLPF FPTKLDLNTN VEKDVASSYK QLDLNGFSWN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094327.11e-137PREDICTED: uncharacterized protein LOC105174060
TrEMBLA0A068V4H41e-118A0A068V4H4_COFCA; Uncharacterized protein
STRINGVIT_08s0007g07580.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451